DPCstruct | MC48691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1HUP4 | 4-119 | IKKTIEKVEGFANLSKGWRFGKGDAIDQEKRFFAVRLLEYASQYEITRANVFALADGGLLISFYIGKHTLDLTLEADGTLTTAEDFE… |
| A0A2C9CFK0 | 26-155 | ETEQQEWNTSIVIDIYPQTPSLSNAAMKATSKILGFRNFADNWDSYGAEKPSESAIVNALSFIRVIDAHGIPVYFVAPGPNGEIVVE… |
| A0A809N6W4 | 3-105 | None |
| A0A7V2ZL75 | 68-181 | None |
| A0A7Y4ZJQ2 | 27-141 | None |
| A0A519Q4V4 | 59-184 | None |
| L0DHX0 | 22-136 | None |
| A0A0F9U9C8 | 11-145 | None |
| A0A809RPA3 | 43-164 | None |
| A0A850M520 | 221-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.