DPCstruct | MC48688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 99 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2FQ49 | 22-120 | ARFAVGLRVRDCHHQVSGKRDGARPVWFYGLTDRSWACVMFRDGHREAMVWQSGPRRLWDEVSAALDWWRAAGEPGYERFGLTVTVY… |
| H0BJM8 | 5-84 | DDGSYTLWTYSDDGRSWASADYEPGAESFEVVQAGPRRLWDATEAAHAWWDAQGRPDFERFGLTVSREGQRAWLDSPDNP |
| A0A1Q5M1X7 | 5-92 | None |
| A0A6N7HJW3 | 138-265 | None |
| A0A387H6T2 | 175-277 | None |
| A0A1T3NIL7 | 52-171 | None |
| A0A1T3NIU8 | 79-182 | None |
| A0A2N0GMW1 | 1-69 | None |
| A0A5C8QAR2 | 90-209 | None |
| A0A397PEY6 | 42-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.