DPCstruct | MC48685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3KGR6 | 1-139 | MVLMVLVSIPMYICATASTPIAAGLLFAGVSPGAVLVFMLAGPATNIATLGVVGKELGKRSLLAYLTGVIATAILFGVTLDFALSYF… |
| A0A661B4M3 | 62-208 | LVLAIATPMYVCATGSIPIAAALIAKGMAPGAALVFLIAGPATNTATISFVAGKLGGKVLVIYLAVILMTAFAFGMLLDTIFADFDF… |
| A0A1E7GDK0 | 2-114 | None |
| A0A7C6ATC9 | 126-269 | None |
| A0A5D3WL58 | 4-128 | None |
| A0A7X4AMD5 | 126-245 | None |
| A0A496RN53 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.