DPCstruct | MC48683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3KE80 | 36-206 | LSPEWVQILKQNVSIYSLLPEPLKKELHGRINIFLNEKEFFSFGGLEISDETQLTVAGNACLLLLNRDKRCFPEFKSILMYPDTYVA… |
| A0A1W6MJY7 | 7-142 | VILESYAFFAGLNVKNKKEFEHRVANFIADKDFKHRYGTPVTDEQKALISAVACRLSFGRRSYLFPTLDTILIFDQAFTSPINSNLH… |
| A0A177Q1N8 | 8-167 | None |
| A0A286ILH1 | 23-200 | None |
| F5NW94 | 2-138 | None |
| A0A3S0E9P4 | 34-185 | None |
| A0A520QJ85 | 3-142 | None |
| C5T3E4 | 107-266 | None |
| A0A2D4SG62 | 57-190 | None |
| A0A518HQG3 | 2-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.