DPCstruct | MC48674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10990 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5RA17 | 6-123 | LVYGCATLALFAIEVLIARYVHDGLIRPYAGDSIVVVLLYAALRTMTPLDVRAAIGVAFAVACAVEVGQYVHLVDRLGLGHSALART… |
| A0A1I0PZP1 | 5-125 | IGYSIVFAILLIAEILIGRFATGFVRSYIGDVLVIPTIYFLLRIIFSKDNIFSVYVLPLLCYCLGRVAEFLQLIDITGILGIDKGSL… |
| A0A5F1YD66 | 15-130 | None |
| A0A840YS10 | 21-142 | None |
| A0A2N7L405 | 2-107 | None |
| A0A1K1S1D4 | 45-164 | None |
| L1P943 | 10-130 | None |
| A0A1G9H488 | 2-104 | None |
| A0A5Q4ZKX4 | 13-134 | None |
| A7ZC20 | 3-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.