DPCstruct | MC48673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 282 ± 40 aa |
| Standard deviation of domain lengths | 39.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366PWT0 | 281-594 | MVERKFQIIDKYDFNRTYHGIEISEQWQAWETAHFFRVRSIIENPTVGARLISYGCDNGDGSSLNCTTTCSNATLMYNSPENLWNCM… |
| W9P726 | 1-335 | MDQGIVRVINGGWMDGLTRDAVSRPDTSTILWETLYEPWNLFARLDKGDRVAVAEPVTLLRDVCSGHDSPGKNCSIVCNSSDDMFAS… |
| A0A5Q3DS03 | 4-206 | None |
| J3P559 | 65-299 | None |
| I1R976 | 1-287 | None |
| A0A365N557 | 1-288 | None |
| A0A2T4GVD2 | 2-270 | None |
| A0A428SC72 | 1-282 | None |
| C7ZG27 | 1-263 | None |
| N1SAC3 | 1-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.