DPCstruct | MC48669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 51.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A544ZX06 | 1-79 | MFLLGSTFAKEESTVINIGDPEGPPRLISYLSSSQGFDWNPEIFLPSYIDCEYTPLENRREPVHEILLTDEESKEMLPQ |
| A0A395N8T5 | 394-468 | GSALSKQECTVINIGAPDGPPRLISYLSSGQGFMWNPEIFLPSYVDCDYVPLENRRDPVHEIHLTDEEMKKMLPE |
| C9SGK4 | 139-251 | None |
| A0A163HKD7 | 27-133 | None |
| G0S284 | 77-152 | None |
| A0A6S6VUV9 | 56-160 | None |
| A0A165G9N7 | 41-146 | None |
| A0A6J3LY08 | 208-294 | None |
| A0A0D2A945 | 66-174 | None |
| S3BSC0 | 82-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.