DPCstruct | MC48665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7IMK5 | 36-140 | PKQEEYLGNYEEVFYQPKTDETRAAYDEFLNLIRQPLAGQPLSTLGFVAYIIVEILKNETGSKYPWNKRKHIDLILNPISDHVFDQL… |
| A0A397BVS2 | 104-186 | FSYIPSTDVSRAAYEELLQVMKKYLGDQPSEIMADAAEEILQIVKNDDYRDDEKYRETTKFLQGMPSHEFSHVVEMAKRMTDF |
| A0A366SCE9 | 621-722 | None |
| A0A445AUZ3 | 74-179 | None |
| A0A819LVP0 | 30-172 | None |
| A0A822DTW6 | 37-133 | None |
| A0A6I9YC43 | 89-196 | None |
| A0A200R286 | 31-131 | None |
| A0A0C9X4U2 | 51-154 | None |
| A0A314Z3Q5 | 97-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.