DPCstruct | MC48662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 194 ± 25 aa |
| Standard deviation of domain lengths | 24.80 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0063- PF07058 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7FJ91 | 23-211 | SAVNILMIFCVITTNLFALYAFTSSSSKNHTTTNTNNSNLNLHKNISLVSEQVSLILREIDLSQKKLAQMEKQLLGYESIDLSRPNI… |
| A0A835S7F2 | 27-202 | LLLLVSSNLLTFFLFSPNSLRIPWSDRVPRIHLWDSEALLRELNSTQVHLAQTQSDLSDLQRRLLTSNSLLETLLTELGRIHGDSSS… |
| A0A811MSC5 | 710-922 | None |
| A0A067KJL4 | 18-193 | None |
| A0A067KJK8 | 27-204 | None |
| A0A835ISD5 | 3-156 | None |
| A0A5C7ID23 | 11-236 | None |
| A0A6L2JKE6 | 4-192 | None |
| A0A7J0F0E3 | 1-229 | None |
| A0A2R6RJ60 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.