DPCstruct | MC4866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 286 ± 60 aa |
| Standard deviation of domain lengths | 60.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF13870- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813EZK8 | 5-181 | EQNLDILRALMEETDIRTAEVKRDAYEFRRDIVVGAENPRTGKTMAEKVLKYMEDKLTQKDMQINKLLMKNQAYKIAIKKAETQLKS… |
| A0A6V2XFB7 | 19-280 | EVAALEIDDIREETGEVRAQHEALMDALRAQIEATDVRIAEIKKDAYEFKRDIVIGAESSRTGKTVAEKAVRYMDDKIRAKGAVTEK… |
| A0A812YN97 | 2-226 | None |
| A0A7R9PB85 | 105-452 | None |
| A0A812TSG2 | 74-354 | None |
| G0QRU1 | 1-200 | None |
| A0A7J6ZNI5 | 2-254 | None |
| A0A418AWW2 | 2-219 | None |
| U6L2F4 | 33-379 | None |
| A0A6A0AG15 | 20-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.