DPCstruct | MC48657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 177 ± 18 aa |
| Standard deviation of domain lengths | 18.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3DX03 | 21-191 | QHFKGFNAMTDPPSKPKKHPEVDIYEALKEGPIVQFFEQAFEWEQMTYIYYPYFWGRKKNWIEVSKISDPDPLFMQFLNAGYARVVV… |
| A0A645AYW6 | 315-470 | AAANQAAAEQEKENKEKKANFYRSTEANILKHNCIAYLLQSYAALGQTMSYDDGQQMQSFKMLFGDNLDNYTALAKFMEQAFEWQIM… |
| A0A3N1PPL4 | 658-821 | None |
| A0A679HXP6 | 698-879 | None |
| H1ZED2 | 6-147 | None |
| A0A1B9Y6V9 | 415-578 | None |
| A0A854GBM0 | 98-276 | None |
| A0A849F990 | 24-181 | None |
| A0A2V1B1R3 | 28-207 | None |
| A0A371K8X9 | 361-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.