DPCstruct | MC48653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7DQP4 | 3-95 | KMKKSIDLQVSELANEAVQEKLTTEFGKVFDNIHDLNTKATDKRTVTVKLEFKPDDTRQVVSLTTSFTTKLADTEPVGTTVLTGKDI… |
| A0A0E1L0K9 | 1-75 | MEKMINLETFADGALAEKINMALKEVLENIADPNTDYKTKRKLTVDMTFASGEDRELTEVEIVAKPKLAPKESVS |
| A8SB95 | 1-96 | None |
| A0A8B6JDH4 | 1-101 | None |
| A0A1Z4JP66 | 22-123 | None |
| A0A6A7KA47 | 1-97 | None |
| A0A416S7L4 | 5-109 | None |
| A0A0R1LQ79 | 4-105 | None |
| A0A3R6UDA8 | 3-102 | None |
| A0A839HA33 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.