DPCstruct | MC48647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 8.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532V1P5 | 41-145 | SFSLINRTISLNRYQQSQSEVDSWTSCDKFYHLFASAFISGMGLWALESTHNDPQQSMISSFGITVGLGGAKEIYDSHHPHRQASWK… |
| A0A3D5V8Y5 | 4-109 | GLLFLLLIIYCNSVSANWFGRDKIMHLGASSVLTYWSYGISKNILEQNSQQSSLTAAAFSINIGLFKEYSDRYIKKESWSWPDLVYD… |
| A0A2E9R296 | 10-125 | None |
| A0A117MAV4 | 1-126 | None |
| A0A383WD71 | 2-124 | None |
| A0A838NM06 | 13-109 | None |
| Q08XG1 | 1-100 | None |
| A0A7V0T422 | 44-146 | None |
| A0A848XXC0 | 25-135 | None |
| A0A7X7ZXH5 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.