DPCstruct | MC48644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6L8X8 | 1-170 | MWSRGMVVPEKFVSGTYAFKVVEDGKANCTEVVDGWKGAYTNFNGIPRAKAEKEELYTIPENVSFVAMYSPSADATASCRVVTCIKT… |
| A0A6P6RXA8 | 67-166 | GTYAFTPISDSHTKDCCRCNEAIRTWKAAFTNFTGLPPSKDDGVDLYKDINNVSLVAMYNAQTPPVADCRIVKCTEKDTNALGVVCL… |
| U6JWX1 | 89-246 | None |
| U6KBT9 | 63-202 | None |
| U6KEP1 | 336-485 | None |
| U6K7G4 | 117-265 | None |
| U6K4C5 | 155-288 | None |
| U6K063 | 1-143 | None |
| U6JT10 | 130-241 | None |
| U6N497 | 105-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.