DPCstruct | MC48641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 265 ± 27 aa |
| Standard deviation of domain lengths | 27.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A197JJC0 | 1-228 | MVKVASPLIPSLITLLAFTKDVFAQKNTGNCILQLPTNPLTAEGLATPFILVKGNCDQTNPNHRVFVEATIFDPNTKTFGVYHPLVI… |
| A0A2V9ZRD6 | 139-370 | TAQAPQVANPDCTLIMPNNPLTPAGLATPYVFTATDPDNGPCHELNADQSAFVQAGIFDPATGQISVYNPLVIDQGTAPAAPPVVPT… |
| A0A507CAQ2 | 12-242 | None |
| A0A1H7ZV72 | 1-288 | None |
| A0A2J6R974 | 1-286 | None |
| A0A838EP96 | 1-281 | None |
| A0A507DQ05 | 4-252 | None |
| A0A507CF66 | 373-668 | None |
| A0A1Q4DX00 | 1-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.