DPCstruct | MC48634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 793 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 22.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.72 |
| Pfam Score | 70.36 |
| Assigned Pfam label(s) | CL0327- PF07963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A486XKB4 | 2-103 | IQANRTAATACLTEMAQFMERTYTQNMTYAPVGIGIPAIGCVNELGQRYTFSLANLGRRTYTLSAVPTALQNDADCGTLTLNQAGQK… |
| A0A1G1W6C8 | 6-134 | SKKKNRGFTLVELLIVIAIIAILISIGFASYGRVQKNSRDTQRRSDLRSVAGALEQYYSDFNRYPPMLDTLKDDVLPSGSHVTYLKD… |
| A0A101G4U3 | 1-130 | None |
| A0A1E4PRK6 | 3-106 | None |
| A0A182U2D8 | 5-115 | None |
| H8H2T4 | 146-272 | None |
| A0A1E5AX30 | 38-161 | None |
| A0A258HAD6 | 1-122 | None |
| A0A1V5FH59 | 3-155 | None |
| A0A1V4WJJ8 | 44-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.