DPCstruct | MC48632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2SUN3 | 6-87 | KKTLALLFLTASALAAYGLWLMLRPVEIVAVHKQGNHSSVLVKSFPPTEKGKINWWPQNKDVLKNKYNIPEPDQDGYFVMVF |
| A0A4R7GWN2 | 2-92 | LVIMAIVGYLLWLWSRPVKIIAIHQSGSYSDVLVKDYPLTDTGKMDWWLKNKEVLKEKYNIPKPDEDGGYHVVFWDFDKGYKEEGKY… |
| A0A735ZSI7 | 5-100 | None |
| A0A6M8UHR8 | 1-90 | None |
| A0A3R9GNB5 | 20-143 | None |
| A0A378XKL2 | 1-94 | None |
| A0A352MLS8 | 23-104 | None |
| A0A2X5AND4 | 218-299 | None |
| J1G8J9 | 7-107 | None |
| G5R5G4 | 12-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.