DPCstruct | MC4862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5W210 | 14-155 | SQSHPSSNFSPAERIQSLVAGIWAGVSVGTIALMMELTVSGILGEGLPLDVHLIVKGAIAIISGFLFGVTYRYTVRRDNNPQLKLGV… |
| A0A6U8N289 | 17-181 | TAPVFASPLRCAGVRCSDPERKAVFSEERSESVKAGGIASLTGTMASAPVKASAVLATLPVKATALASWQISTCVFAVQLFLFGIVY… |
| A0A351KY18 | 3-145 | None |
| A0A4S8IFG8 | 189-344 | None |
| A0A7S3FMP8 | 97-243 | None |
| A0A7S2HB25 | 165-345 | None |
| B8CAB6 | 25-200 | None |
| A0A1Z4URQ8 | 17-197 | None |
| A0A2I0A3W5 | 170-316 | None |
| A0A0P0XQV0 | 42-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.