DPCstruct | MC48618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1B5P7 | 84-183 | LIVKLNLVNRSGTLQLTEQQSQMPLLFLPWQLDAQYLTIKHGNWRWQNGDQLLSGKIDLRLANWRDNLADMRISGRANMLTTGGEGK… |
| A0A377M200 | 22-103 | LVMARDNPDPLLDLPWQITAQQLNISDGRWNWNLSGMPMSGRVGLRVDNWQQGLEKATFTGRPQCSDSGDAGKGNAVLNLGR |
| A0A377ZTZ6 | 195-303 | None |
| A0A6V7KI40 | 184-284 | None |
| A0A376ZS22 | 195-311 | None |
| A0A376TGB2 | 1-86 | None |
| A0A447LPW8 | 1-111 | None |
| A0A376YHW8 | 1-83 | None |
| A0A376KUQ0 | 195-301 | None |
| A0A381H2V2 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.