DPCstruct | MC48615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF06276- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377LYS5 | 1-108 | MENRFGESQLLRYFPYYLLLNSTLAVTAALAAAGFDSEESLMSRVRDALASLRQTAKQTRCLDYVLDSPTWNCKGNFFCYLHDRNEN… |
| A0A086CZP1 | 47-163 | DHFLARHPQLAEAPENHWSRDTLRRYFLYYLLINSTFAVTSALAADGLAEEALLLADLRAHLEGLRERLDGDLDCLEHALNAAELEV… |
| A0A5S9M4H2 | 1-131 | None |
| A0A7K2I4L5 | 65-186 | None |
| A0A7X7GSJ5 | 2-114 | None |
| A0A1T4VYR4 | 134-252 | None |
| A0A3C1AW83 | 12-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.