DPCstruct | MC48612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377LV79 | 8-136 | LEMGVFAGILTGALSGYLYNKYSGVQFNGAMAIYSGHCFVAIVMLPVSMLLGVVMSELWPFAQHGISAMALAIKGSGPFGVAIYGFL… |
| A0A176UBH4 | 129-240 | GILSGVIGSSCYNKFKNTKLPNWLAFFSGKRCVAIIAGLVSIIVSAVLLFVWPLLFGALVALGDAVAGMGIVGAGIYAFLNRLLIPT… |
| A0A1W9F4D5 | 28-146 | None |
| A0A7X2T1U8 | 209-358 | None |
| A0A0U3NQ23 | 139-259 | None |
| A0A7K3G371 | 2-98 | None |
| A0A6L5XQN9 | 134-249 | None |
| A0A857DBG6 | 137-271 | None |
| A0A377E5C1 | 35-155 | None |
| A0A377YU57 | 88-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.