DPCstruct | MC4861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074XBS0 | 317-417 | ICAYCGLVSPDPEHIASHNHDYCQSRDPDARIFLRKDHLRQHLRSVHECDMLAHMDHWLLEAVWVNSRCGFCGDRFSIWSERNEHLA… |
| A0A395RJA7 | 491-604 | SPDSLHPESGKRCCVFCSQEDPDQEHIQAHNPSACQERMFNRKDHLRQHLRLVHRADFVPWSMDSWKDTISDVRSRCGLCGIMFNTW… |
| A0A6G1IF64 | 400-501 | None |
| N1RMB6 | 34-151 | None |
| A0A5N6WUD1 | 1121-1229 | None |
| A0A5M9LLZ7 | 262-385 | None |
| N4VMC1 | 228-327 | None |
| A0A0U5GID3 | 319-420 | None |
| A0A0J9UWU7 | 394-515 | None |
| A0A6G1HY76 | 218-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.