DPCstruct | MC48600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0M333 | 12-108 | AYIGVSCTPTHLHLCSYNAESICMKDGKDIDSLIPYLNKNAINWIQIHGFQNTEVIQHVCQNFNVDFLTIQDILNSDHQTKIEQHDT… |
| A0A5C6DSH9 | 15-111 | TLVISPNASPVEMRVTHLSGQDRSSFVCPTVEELPKLGKTGSLLWVDVHGLGDGSVLQKLAKRFRISPLAMEDLVNVPQRPKSEVFK… |
| A0A495ZCV3 | 1-88 | None |
| A0A822FIU5 | 56-141 | None |
| A0A7J3NRV7 | 28-119 | None |
| A0A395IF91 | 23-124 | None |
| A0A7C4HP65 | 293-388 | None |
| A0A7C1RSY1 | 73-158 | None |
| A0A2N1KR24 | 23-109 | None |
| T2I9P3 | 26-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.