DPCstruct | MC4860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0UAS1 | 6-121 | KRRSRAYPGVQTCLGSFIGISNERHWWYATGKAREDFEAVEAYVQEQLEADMKDSYRSTVYFKLFMIGRDEISAKPTIMFFCEEKEP… |
| A0A4Q4RN91 | 376-486 | RWEFRLESRGPLEYKTGQYNWWAADCPEAQVMKDALGATLWDHVCEIEELNSVEQYFALNLFFVGSTLQQSRPVLLIFSMTKQGRRE… |
| A0A6V8H852 | 9-160 | None |
| A0A162LNW3 | 11-139 | None |
| A0A098D5X3 | 37-183 | None |
| A0A4Y8D7T5 | 14-145 | None |
| A0A6A5UF64 | 5-128 | None |
| A0A2V1BGB1 | 2-154 | None |
| A0A2J6TKR4 | 6-184 | None |
| A0A4Q7K9K4 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.