DPCstruct | MC486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 124 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4XJX7 | 1-127 | MAVCLEFIDLIIPIEAIERVYPGGFVKWKQDEGVEGQVSGRYWYDEYLLRDGAMGPQVMEDMVREWEQRGLTALAMENGQRVWKDVC… |
| A0A2V5U677 | 26-153 | MAVLIEAISVVIRAEAILAHYPGGWEEFRDACPNQTLCADGELIRVGFMTPQDTQRFIEDLGRHGIEYLRDGRAADLVVADQQRGLA… |
| A0A7K0FKY4 | 2-104 | None |
| A0A7X1FRL7 | 13-138 | None |
| A0A518I3L7 | 1-122 | None |
| A0A7C6W5B0 | 1-115 | None |
| A0A2N2N9P4 | 1-118 | None |
| A0A0F2QUP3 | 1-131 | None |
| A0A0S8EIT9 | 5-131 | None |
| A0A7Y5KX95 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.