DPCstruct | MC48597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6N5F6 | 1-60 | MAVTKEQIVTDLAELGIRPGVTVMMHSSLSALGPVEGGAEAVVDALLEAVGSDGTLLVPA |
| A0A0I9S9I9 | 1-65 | MITFDSLRNDLKMLGVSSGDLLFLRISYKAIGRVEGGPKTFVDALLDVVGKEGTIVVTAFPSRYS |
| A0A1E1VPG4 | 5-83 | None |
| I2GLB2 | 4-84 | None |
| A0A1C6BZI7 | 1-61 | None |
| A0A815TDQ3 | 18-95 | None |
| A0A819QPN9 | 686-763 | None |
| A0A378HCB4 | 6-91 | None |
| A0A2D6CUG9 | 238-303 | None |
| A0A3D4GYM5 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.