DPCstruct | MC48589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 185 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1FKD0 | 137-304 | RITALKEINFCSGSHFIRAGAPTMRFGDSNATAAAAPQASSLRVRHVLDEGERQSAALSQHGDYVVRGAYQLHPGTTVYGNIKTYGD… |
| A0A272EMW2 | 2-158 | RLEAPVILFGRRADTPTINRDDPLPRFDPPAHTGDGPGRGRHLSVPAGHMIKAALLVSGRLEIGEGCHVIGDLRAGRGIIIGRNVVI… |
| A0A7G6E067 | 166-341 | None |
| A0A1Y2QCN5 | 25-236 | None |
| A0A7W0F1I0 | 168-338 | None |
| A0A0S8K9P8 | 219-405 | None |
| A0A7G5EGS6 | 6-245 | None |
| A0A417SAQ3 | 162-344 | None |
| A0A0F2Q9Y7 | 166-338 | None |
| A0A7C5WD60 | 354-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.