DPCstruct | MC48582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399FYR5 | 11-130 | VNTPIKAQQVALKELSEDARARRPGLKWSLDLERARLLTESYKQTEGEPMALRRAKALAHILANMTVYIRQGEMIVDNYASNSDSVP… |
| A0A6N8Q6C1 | 2-90 | TTLKLDTLSDRIKAHKNALVHIVKPPVCTERAQHYTEMYQQHLDKPIPVRRALALAHHLANRTIWIKHDELIIGNQASEVRAAPIFP… |
| A0A5N7ZFL0 | 1-134 | None |
| A0A3S4H7D8 | 216-362 | None |
| A0A396R0A6 | 12-112 | None |
| A0A1V1PHJ0 | 287-415 | None |
| A0A538QX69 | 24-177 | None |
| A0A827JIE1 | 1-124 | None |
| A0A2V1JUV2 | 24-155 | None |
| G5RST5 | 4-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.