DPCstruct | MC48581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 183 ± 12 aa |
| Standard deviation of domain lengths | 12.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q1NBR8 | 1-179 | MADIEGTDPISGAADETATRHQLTGLIGRSAPLPIWAHLDAMKDWLARARQAATQADQRGSAAAEWLLDNDYQIQRAILQIGEGLPK… |
| A0A1Q6LFS4 | 6-181 | KLQINGTMLEKEQLKKHLEKIASSHNIINKSQKDTYPVPELIKDYEIIKEVYKMLNQHVSMKINIHPAGEWLLDNFYIIEETVKQIE… |
| A0A1H3GS05 | 12-209 | None |
| A0A2V8MDE1 | 23-203 | None |
| A0A1D8QV26 | 29-220 | None |
| A0A2M7ZVX8 | 32-206 | None |
| A0A3S4EDF3 | 24-216 | None |
| W5YU17 | 2-183 | None |
| A0A1F9NEB3 | 27-209 | None |
| A0A485CQ32 | 28-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.