DPCstruct | MC4858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3EZW2 | 1-49 | MDFNFRNVDETGQGFCDEIFRVYANRNPGKLLSYHGASDVVRYMIERSR |
| A0A845JV30 | 4-54 | FKHVVLDFRDISTVGQGFVDEVFRVFQSKHPKIRIEYKNVNDDVKFMIERS |
| L0D9F9 | 133-179 | None |
| A0A3D4HYT1 | 91-142 | None |
| A0A7C1AXE6 | 8-64 | None |
| A0A7C3C0J7 | 4-60 | None |
| A0A7T9DH95 | 12-63 | None |
| A0A257EJ05 | 6-58 | None |
| D6BFB8 | 85-138 | None |
| A0A7Y4SVC5 | 20-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.