DPCstruct | MC48572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 298 ± 42 aa |
| Standard deviation of domain lengths | 41.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TPX8 | 22-285 | WKKMEVRSWSELLNRVETDGQMGALLVSFPLFDALFKEETADSATSLSAMAAEWITNGTLLDYCMRIRSVRILAKWAALLGKSSLGS… |
| A0A0R3QWS6 | 215-529 | ADRKHSLMNELEELRHLLVNWRKMEVLCWDNLLEQVQTDCCTQTLLLSWPLFEALYKVDKGDDEILAMTIEWIQNSTIIDFKARLLT… |
| A0A7J6RSI2 | 43-406 | None |
| A0A2H2JLF7 | 329-650 | None |
| K5VYC4 | 562-882 | None |
| A0A6L5CTX6 | 5-279 | None |
| A0A1X7TK49 | 140-436 | None |
| B8P5M1 | 104-422 | None |
| A0A3P8D3C0 | 118-468 | None |
| A0A6I9XRE1 | 54-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.