DPCstruct | MC48569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 19.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1THJ2 | 5-102 | EHISDTDILTCCVGKCGNGCKGGDVKEAFDWIIEHGVCTGGRYKEKNVCKPYPFYPCNLHGNGTYYGPCPEDGFSAPKCRKTCQLTY… |
| A0A430PX82 | 80-170 | LSAVDLVSCCRGCGFGCDGGFLGPAWDYWVEEGIVTGSSKENHTGCQPYPFPKCEHHAIGKYPACGKKIYKTPRCKMTCQKSYKIPY… |
| A0A1D2NKT6 | 140-237 | None |
| A0A6V7WH21 | 183-293 | None |
| A0A0M3IRP0 | 171-279 | None |
| A0A482W0N1 | 121-240 | None |
| A0A0D8XXP3 | 41-144 | None |
| A0A3S1BCP9 | 989-1078 | None |
| A0A5S6QTM7 | 647-744 | None |
| A0A5S6QQY4 | 222-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.