DPCstruct | MC48567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 95 ± 17 aa |
| Standard deviation of domain lengths | 16.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TGF3 | 16-102 | EANRKKVALPPGFEGKLGKAIAAEFAPIASSIYQCMDLQCLCTYLRGLAAPNGQCTLPNGQTLRKAIRKEYRMMSDDERQRYHAAVQ |
| A0A016W310 | 26-118 | CGKFPEDGELKTICHRLVKWDQEARDLWPNISQLEAPTKQTVYDCTDLECLCRFMNGEWKFGAFGSDCRLKGGNVLRTSVRREYRKL… |
| A0A3P6THE1 | 43-127 | None |
| A0A183HIT4 | 43-122 | None |
| A0A368G875 | 33-122 | None |
| A0A368F2Y4 | 1-65 | None |
| A0A368FM62 | 248-334 | None |
| A0A0J9YFM9 | 20-121 | None |
| A0A0B2V753 | 69-150 | None |
| W2SXX3 | 46-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.