DPCstruct | MC48566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0213 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TFK6 | 1-118 | MSHGAPVCSSKIRLGASCAGYSRGENPCYNGACQGGRCVAAGPVVSTMAPVPAVTAAPVVIAPQETCFNENQCCATWAARGECTRNT… |
| A0A0M3J3X7 | 145-276 | GLSNLYTDQLYRYAPRPTCTLQMPTCDSPYLFCDTLAVNAHCVSKIKLNGRCSGFEGLDACYDGVCQMGFCVPGPTPPPFKRPERKT… |
| A0A0K0DWB1 | 395-563 | None |
| A0A0B2V753 | 370-520 | None |
| A0A0B2V5S1 | 1056-1213 | None |
| A0A2L0VDJ5 | 588-740 | None |
| A0A2A2KBL1 | 411-563 | None |
| A0A6V7W439 | 2-109 | None |
| A0A4X3P8X3 | 386-534 | None |
| A0A0R3QQ18 | 485-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.