DPCstruct | MC48563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 19.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660ZYW9 | 4-100 | VKEPAKKPTPKPPPYSAEFLEFWAAYPRKIGKGAAWKVWKQRKDRPKNGDMLASVEAHKRSEQWTKDGGQYIPHPATFLNQARWEDE… |
| A0A0L6KD64 | 8-82 | QFEQFWKSYPRRIGKGAARKAFEKALKLASFEEVMTGLHRQIPYYQSREQQFIPHPTTWLNQERWADDPQPTRER |
| A0A1Z9PP91 | 3-86 | None |
| A0A6G2BDL0 | 197-321 | None |
| A0A3M6C1J6 | 68-174 | None |
| A0A7K2ZRN1 | 16-156 | None |
| B4DBY5 | 135-262 | None |
| A0A370I4S6 | 83-171 | None |
| A0A401FPG4 | 79-217 | None |
| A0A4V1PTL3 | 146-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.