DPCstruct | MC48556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.58 |
| Pfam Score | 91.65 |
| Assigned Pfam label(s) | PF18913- CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EEJ5 | 1-63 | MRIPQKGKIYSVNEGYTSKWSKGVQEYVHTRKFPSHGEPMNGRYVGSMVSDIHRTLLYGGILC |
| A0A7J7BI98 | 391-464 | MRIPTRGKIYSINEGYAYEWDPAIREYVHSKKDPKNGKPYGARYVGSMVADVHRTIKYGGIFLYPATTSTPKGK |
| K8ELW7 | 262-338 | None |
| A0A1G5J7Q2 | 70-148 | None |
| A0A6A4JS62 | 968-1042 | None |
| A0A1E3H0U0 | 36-113 | None |
| A0A1R3JRM5 | 263-341 | None |
| M7Z581 | 202-275 | None |
| A0A5S6QKP5 | 250-324 | None |
| A0A2R8MAM5 | 246-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.