DPCstruct | MC48551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 180 ± 31 aa |
| Standard deviation of domain lengths | 31.35 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S0TI27 | 1-145 | MQRGREVEPASPEAFHVPVVEGLPAQYQELLVVPEIDPYTVIRNADGSVIIECGICPKEFGTLKGWRIHAAKMHRQNGFCQKCGHFI… |
| J9E9I2 | 24-235 | DGPEPALVHHESSSEEVAMVEWRSVPQESDEEMLDVVPTAPTEVPRRRRVERIREIVLRSRTIRVPVMEEEVSNAVQSGPAAFQPPV… |
| A0A0N5DC73 | 78-281 | None |
| A0A0R3RP17 | 59-215 | None |
| A0A0J9Y012 | 94-278 | None |
| J9EBC2 | 58-239 | None |
| J9E4L6 | 1-169 | None |
| A0A0M3IL48 | 233-455 | None |
| A0A0M3IHI6 | 46-272 | None |
| A0A0R3QJ13 | 3-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.