DPCstruct | MC48548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9E5H7 | 1-121 | MVAEFEKYVKEGVSPEVRDEMLESKPGLNWDRFGFIVDMNHANMIFNRERNDACDEKDRQWKCLEAFRAHLQFLNERALKTGAEIYK… |
| A0A182ETG6 | 98-217 | VAKFEKYVKEGSSLEVWDVMLESEPGPDWNRFGFIVDMDRANKIFNRKRDDAYDEGGRQFKCIEAFRAHLQFLNEKALKIADGIIEN… |
| A0A368FI50 | 154-274 | None |
| A0A182T4T2 | 328-447 | None |
| A0A6P7TYJ5 | 10-120 | None |
| S9WDR6 | 134-248 | None |
| A0A2H2JNG9 | 294-416 | None |
| A0A811KD39 | 296-414 | None |
| A0A0N4T450 | 310-430 | None |
| A0A423T9T8 | 533-669 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.