DPCstruct | MC48547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 287 ± 37 aa |
| Standard deviation of domain lengths | 36.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9E4M4 | 2-314 | KQKASAYYILCYRNASLDKSCRTLSFGWLVWDILCQIKQEVRMIRGKSIVQSLDPLGESASEFIKNYCEANAEDMKWTLAYVMKTKQ… |
| A0A016STI1 | 2-277 | LESRLDTFYIENQEVLISFERRIREVNSHLLMYMKHYPGLERVMFLVCWWAKQNRLLGGCLQEEHVCIILILFATGTIAGSVNVMEP… |
| A0A1I7WEF9 | 135-349 | None |
| A0A0K0DW45 | 1322-1622 | None |
| A0A0D8XSJ5 | 210-520 | None |
| A0A0M3INC5 | 427-678 | None |
| A0A0B2VWY0 | 362-680 | None |
| W2T4Y6 | 120-417 | None |
| A0A4U5LW83 | 69-380 | None |
| A0A3P6R3A8 | 1-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.