DPCstruct | MC48543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 317 |
|---|---|
| Mean domain length (aa) | 265 ± 59 aa |
| Standard deviation of domain lengths | 58.81 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 97.52 |
| Assigned Pfam label(s) | CL0220- PF05421- CL0030- CL0680- CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9DWQ1 | 22-272 | IAIHHVDNVTRVLFEAFDTHYITASHLRSSAATTLTDDFVEEEEYNWTFTTALFFTATLLTTIGYGNLVPVTFQGRMFCIVYALFGV… |
| A0A2I4AM18 | 9-216 | TSCIIFYLFIGGAIFQILEERNWISARDTYIQKKEDLLRKYTCLTKENLNEILEVASQAAGQGVAITGEKHRNSWDWSNSVIFAATI… |
| A0A6A7FWM0 | 55-341 | None |
| A0A0R3UMT3 | 7-224 | None |
| A0A7S4P222 | 15-202 | None |
| A0A0D8Y0P3 | 3-211 | None |
| A0A0D8XMH2 | 12-256 | None |
| G0PKR9 | 18-266 | None |
| A0A7M5UVZ8 | 92-397 | None |
| A0A6S7FGY4 | 368-620 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.