DPCstruct | MC48542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3S741 | 1-131 | MAMFNFACGSGYSTYIQVRQCIRKITTREHIRECVGEFSRSSPQIACQSSKKLLACSLPIINEKCGQLGVQFVTDYIDKFVNVVDPT… |
| A0A158Q554 | 687-820 | AMFQYACGSGYSLYNEVKQCIRKMTTRDDVRECVGIFSKSAPQVACQSSNNLFFCTAPAIKDKCGVKSEQFIKEYIEMFATAIDPDC… |
| A0A1I7X310 | 155-261 | None |
| P34434 | 714-856 | None |
| A0A6V7TXC9 | 187-333 | None |
| A0A3P6TG34 | 476-605 | None |
| A0A2A2LGE6 | 660-789 | None |
| A0A2A2LDC2 | 363-492 | None |
| A0A0N4X229 | 614-756 | None |
| A0A158QBB1 | 346-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.