DPCstruct | MC48541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 183 ± 38 aa |
| Standard deviation of domain lengths | 37.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0392- PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1KNU1 | 1-209 | MLPLMTNSKLVRESMVKGGVLYLLDIFCNSSDHKIREKSAELLAKMTIDKLNGPKIRLILCKFLPVSFIESMKESPQEAVNLFDRNQ… |
| J9DUK6 | 28-213 | GVFFFILMYNGSNLLPIARFLHYTHMKQAFRSAVAKSEFVSHSILSPLLPEAAILYLEEYGAEKFAQTFLGEFDNPEVIWNNEMRRH… |
| A0A2R7VQB7 | 130-283 | None |
| A0A3P7MI83 | 3-179 | None |
| A0A183HJI5 | 17-196 | None |
| A0A5K4F6A2 | 876-1043 | None |
| A0A6I9UJW6 | 38-182 | None |
| A0A6I9UMD5 | 23-168 | None |
| A0A368FDJ1 | 635-768 | None |
| A0A5B7E0A5 | 4-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.