DPCstruct | MC48540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 231 ± 29 aa |
| Standard deviation of domain lengths | 29.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183N683 | 4-233 | SVKLFTDLVLKLINGEGKIDILAKLVPELFKIFGGNGSFESNLLDSLWLIDSSIADINSESVRDRFYRLIEILKNHVNPALIMERFC… |
| J9DTK1 | 6-225 | LDVYVFEVSAFIDNIPSLLVDVLAIVDLELSTEKKSEEFRKCFLEFLSHLSDRAISGRNIVINLQIVADDVLKCELDILGANEQTTR… |
| A0A3P7MH84 | 20-223 | None |
| A0A167FQ22 | 30-320 | None |
| F4NSU7 | 114-306 | None |
| A0A6C1EEV4 | 60-343 | None |
| A0A821LYM3 | 53-258 | None |
| A0A7J6ARL6 | 32-282 | None |
| A0A6G5ACT8 | 1-259 | None |
| B2KI97 | 46-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.