DPCstruct | MC48534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.15 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0016- PF18199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9B931 | 10-152 | TAKRYAHGRTLLDLVDFHVMDYLIGNQDRHHYEAFSIFTNAPSYAIHLDNGRAFGRTDFDDDDILLPLKQCCVLRSSTFFTLLKYYR… |
| A0A6I9NX64 | 20-153 | GTRLLDVMDMTIFDFLMGNMDRHHYETFEKFGNDTFIIHLDNGRGFGKHSHDELSILVPLSQCCRVKKSTYVRLKLLAKEEFRLSVL… |
| F4WU70 | 97-227 | None |
| A0A835NWR8 | 294-420 | None |
| A0A356TK78 | 229-376 | None |
| A0A6L5CHW6 | 241-368 | None |
| A0A6J8E055 | 483-639 | None |
| A0A7R8H1Y1 | 88-234 | None |
| A0A4U5UJ14 | 172-308 | None |
| A0A0Q9X9T4 | 577-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.