DPCstruct | MC48532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 386 ± 39 aa |
| Standard deviation of domain lengths | 38.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9AVU8 | 1-459 | MAKFRSCTYYDQLVLCGWCCESFIQMVQDFVDGHSCVLPTAEGLDIILEMCELAQNIAGIMELAEELLPLLVLIERVLLERRVDCVP… |
| A0A2Y9H1I3 | 23-357 | AKFQHLSHYDQHQVTAQVSRNVLEQITSFALGMSYHLPLVQHVQFIFDLMEYSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGS… |
| A0A1Y3BHG8 | 2-376 | None |
| A0A4U5NHH9 | 254-628 | None |
| A0A7R9JHD9 | 3-380 | None |
| A0A0D8XA10 | 3-322 | None |
| A0A0B1S532 | 302-721 | None |
| A0A182TMP7 | 93-515 | None |
| A0A1I7Z8Y9 | 399-742 | None |
| A0A158Q3L6 | 782-1203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.