DPCstruct | MC48531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 342 ± 31 aa |
| Standard deviation of domain lengths | 31.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.98 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0020- PF07970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9AUY9 | 2-366 | ALSDSEERVRRAATVRIIKDVDLKALSIKQRMDLVQGLMNMNARGQNHTVILNDLLREWLKTACGIEALPDSGEELCSFYCIATSHL… |
| A0A5B7CUV9 | 16-381 | RVRLLSEGLKDRHEMVRNAVKKKLIPSWLRLLDGNVLDLLTCLDVEASVKEAELVLKTIFELIPFPDLLKNIGLTKQQRLISPSELQ… |
| F1KTB5 | 193-561 | None |
| A0A1C7N2S4 | 303-649 | None |
| A0A3P6SQV5 | 5-353 | None |
| A0A1B7NN75 | 301-613 | None |
| A0A1I7ZT99 | 307-616 | None |
| A0A0C9PZI3 | 224-599 | None |
| A0A1V9XLT1 | 1-276 | None |
| B0WJ47 | 1-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.