DPCstruct | MC4853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.78 |
| Pfam Score | 86.03 |
| Assigned Pfam label(s) | CL0361- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EJR0 | 1-82 | KRYYCDYCDKSFADNPTNRKNHLSGVQHKIAKQNHYDQFKDPKIILMENFSKKPCHKFQQDGVCRFGEVCKYSHLTSNDIEY |
| A0A814Q3A6 | 1-109 | MGRKYHCEYCDKRIPPGLTHRKNHNRAVQHINNKRMYYLQFKDPAEILLDERSKRMCNKWIQTGSCPFGENCKYSHRSIYELTQLIE… |
| A0A452UPS9 | 62-196 | None |
| A0A2P6NMQ2 | 213-298 | None |
| A0A183T6S9 | 199-298 | None |
| A0A653BNA7 | 1-119 | None |
| W6UDY5 | 3-132 | None |
| A0A3P6I7G2 | 3-115 | None |
| A0A843X2S5 | 4-111 | None |
| A0A397SZU3 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.