DPCstruct | MC48529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 27 aa |
| Standard deviation of domain lengths | 27.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9AJ15 | 13-175 | RSFSEWLRNNTDKWHELLKLHEMPLLPNYGEVMTGGCRSFAKDVMSWPQDLIIGGVRIKNGTIESAEALQSVFLVASPIDIYNRFKD… |
| A0A822E2F2 | 47-223 | MGLLEELKRENFQVDIWEEMLKKAEVGHAYMDRPCLNPIDSNCPPTAPNKNSTKPLDIALVMNGGCYGLSRKYMHWQEELIIGGTVK… |
| A0A6J1NP99 | 132-257 | None |
| A0A4U8URW8 | 125-320 | None |
| A0A6G0HCS7 | 13-194 | None |
| A0A2G8L0D6 | 147-281 | None |
| A0A1L8ENZ6 | 3-108 | None |
| A0A835NDA2 | 262-398 | None |
| A0A183H7E1 | 361-516 | None |
| A0A822CFC2 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.