DPCstruct | MC4852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 278 ± 26 aa |
| Standard deviation of domain lengths | 26.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 48.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0452 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814MSA9 | 1-290 | MSSLLPSSSQINANLNTGNNTLQRSAVNNAAADALRKKMQQLRDELELVKDDLERSRKDYEKEQRAREVAEADVSQLTRKLHSLEEQ… |
| A0A671XV65 | 39-260 | LEDDLVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER… |
| A0A4W2EYU1 | 1-256 | None |
| T1JFS6 | 116-412 | None |
| A0A7J7XSL9 | 1-231 | None |
| A0A6H5H698 | 411-658 | None |
| A0A6P8HLH3 | 315-606 | None |
| A0A0Q9WG30 | 461-778 | None |
| A0A5E4BDG0 | 35-341 | None |
| A0A7R8WCL6 | 32-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.