DPCstruct | MC48518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A504Z431 | 1-64 | MDYLIADVSDVEFVIETQLEKQIGLGCLPFPNMNKSGAGVCKYFIINQCPLNNQCPLRHIKADR |
| A0A6P6C3U0 | 1-79 | MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKG |
| M0QWM8 | 1-62 | None |
| A0A179IHB3 | 60-181 | None |
| A0A0C2ID49 | 2-65 | None |
| A0A2I0T7Z5 | 1-72 | None |
| A0A5F5XVX7 | 1-65 | None |
| A0A2T7PVN9 | 1-79 | None |
| A0A5N3WDL9 | 1-83 | None |
| A0A194PUZ3 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.